Human AITRL
Slide this table
Cat-Nr. | 100-122 |
Size | 20 µg |
Price | 170 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
Length [aa] | 126 |
Molecular Weight | 14.3 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 1.0-10.0 ng/ml. Please Note: Results may vary with PBMC donors. |
Species Reactivity | Human |
Synonyms | TNFSF18; TL6; AITRL; GITRL; hGITRL |
Description | AITRL, a member of the TNF superfamily, is expressed in endothelial cells, and signals through the AITR receptor. AITRL regulates T-cell proliferation and survival, and effectuates the interaction between T lymphocytes and endothelial cells. The AITRL gene codes for a type II transmembrane protein comprised of 177 amino acids, including a 28 amino acid cytoplasmic region, a 21 amino acid transmembrane domain and a 128 amino acid extracellular domain. Recombinant human soluble AITRL is a 14.3 kDa protein, containing 126 amino acid residues corresponding to the extracellular domain of AITRL. |
Protein Sequence | ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI |
Uniprot ID | Q9UNG2 |
Protein RefSeq | NP_005083.2 |
mRNA RefSeq | NM_005092.3 |
All prices plus VAT + possible delivery charges